Getting it into your agent
One page per mod, every tool's command on it. A separate URL per tool would split the same page into five that compete with each other.
npx agentmods add skills/internscience/molclaw/molclaw-protein-sequence-retrievenpx skills add InternScience/MolClaw --skill molclaw-protein-sequence-retrievegit clone --depth 1 https://github.com/InternScience/MolClawWrote this? Show the measurements
A badge with what this costs and how it scanned, read live from this page, so it follows the numbers instead of freezing them. Markdown for a README, HTML for a documentation site or a project page.
[](https://agentmods.dev/skills/internscience/molclaw/molclaw-protein-sequence-retrieve)<a href="https://agentmods.dev/skills/internscience/molclaw/molclaw-protein-sequence-retrieve"><img src="https://agentmods.dev/badge/skills/internscience/molclaw/molclaw-protein-sequence-retrieve.svg" alt="Measured on agentmods" height="20"></a>What it costs to keep this loaded
Counted locally with the o200k_base tokenizer, which is exact for GPT models; Claude uses its own tokenizer and its counts differ. Treat this as one consistent yardstick across the catalogue rather than a bill. Prices are per million input tokens.
| Model | Per session | Once invoked |
|---|---|---|
| Fable 5.1 | $0.00027 | $0.00880 |
| Opus 5 | $0.00014 | $0.00440 |
| Sonnet 5 | $0.00005 | $0.00176 |
| Haiku 4.5 | $0.00003 | $0.00088 |
Grade C, and why
molclaw-protein-sequence-retrieve scanned grade C with 1 finding against 26 rules in 11 categories — prompt injection, anti-refusal, data exfiltration, privilege escalation, supply chain, agent snooping, system-prompt leakage, SSRF and excessive agency — measured 6d ago.
A static scan of the body, not an audit. Every finding is printed with the line that produced it so you can judge whether it matters here. A mod is markdown that instructs an agent; that is exactly why what it instructs is worth reading.
Encoded or obfuscated payloadhighSupply chain
base64 or hex that is decoded and executed hides what actually runs from anyone reading the file.
{'uniprot_id': 'O76074', 'gene_name': 'PDE5A', 'protein_name': "cGMP-specific 3',5'-cyclic phosphodiesterase", 'organism': 'Homo sapiens', 'length': 875, 'sequence': 'MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREM What it actually says
Retrieve Target Protein Sequence
Note:
- Local files are not directly accessible by the server. Please upload them to the server using
molclaw-file-transferbefore execution. - For PDB file inputs, it is recommended to preprocess them using
molclaw-pdbfixerbefore execution. - Please refer to skill
molclaw-scp-serverto complete tool invocation.
The description of tool retrieve_protein_sequence.
Retrieve protein sequence data for a given identifier (gene name or uniprot id) and organism.
Args:
identifier (str): Input gene name (e.g., 'TP53') or uniprot id (e.g., 'P04637')
organism (str): Required species name, e.g. "Homo sapiens"
Return:
status (str): success/error
msg (str): message
seq_info (dict): A dict containing uniprot_id, gene_name, protein_name, organism, sequence, length
How to use tool retrieve_protein_sequence :
response = await client.session.call_tool(
"retrieve_protein_sequence",
arguments={
"identifier": identifier,
"organism": organism
}
)
result = client.parse_result(response)
prot_sequence_info = result["seq_info"]
An example of output sequence information:
{'uniprot_id': 'O76074', 'gene_name': 'PDE5A', 'protein_name': "cGMP-specific 3',5'-cyclic phosphodiesterase", 'organism': 'Homo sapiens', 'length': 875, 'sequence': 'MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN', 'query_input': 'PDE5A'}
What this file has done since we first saw it
Hashed on every crawl. A supply-chain change to an agent config is a question of when, not whether, so the history is kept rather than the latest state alone.
- 6d ago First seen · 48 lines · 27 tokens per session scan C 56ebe8bca5e5
molclaw-protein-sequence-retrieve is a skill published in the GitHub repository InternScience/MolClaw (33 stars, last pushed 1mo ago), licensed MIT. It adds 27 tokens to every session and 880 once invoked, about $0.0001 per session on Opus 5. A static security scan graded it C with 1 finding (encoded or obfuscated payload). No closer match exists in the catalogue, so it is treated as the original; first seen 2026-08-30.
Other skills, from other repositories
instrument-data-to-allotrope
Convert laboratory instrument output files (PDF, CSV, Excel, TXT) to Allotrope Simple Model (ASM) JSON format or flattened 2D CSV. Use this skill when scientists need to standardize instrument data for LIMS systems, data lakes, or downstream analysis. Supports auto-detection of instrument types. Outputs include full…
matlab
Build, review, migrate, and safely plan MATLAB or GNU Octave numerical workflows, including arrays, tabular/time data, tests, projects, graphics, MAT files, and explicit Python interoperability.
exploratory-data-analysis
Perform bounded, local exploratory analysis of explicitly supported scientific files. Use for redacted CSV/TSV/JSON profiles; optional NumPy, HDF5, FASTA/FASTQ, and basic image metadata inspection; missingness/leakage audits; outlier and transformation sensitivity; and rigorous EDA report scaffolds. Other domain…
phylogenetics
Build and analyze phylogenetic trees using MAFFT (multiple alignment), IQ-TREE 2 (maximum likelihood), and FastTree (fast NJ/ML). Visualize with ETE3 or FigTree. For evolutionary analysis, microbial genomics, viral phylodynamics, protein family analysis, and molecular clock studies.
research-engineer
An uncompromising Academic Research Engineer. Operates with absolute scientific rigor, objective criticism, and zero flair. Focuses on theoretical correctness, formal verification, and optimal implementation across any required technology.
mapping-to-snomed
Maps clinical concept spans extracted by OpenMed to SNOMED CT concepts through a USER-SUPPLIED terminology server (the user's own Ontoserver, Snowstorm, or UMLS/UTS), never a bundled vocabulary. Use when the user wants to code findings, disorders, procedures, body structures, or substances to SNOMED CT, run an ECL…