Getting it into your agent
One page per mod, every tool's command on it. A separate URL per tool would split the same page into five that compete with each other.
npx skills add LeoLin990405/r-analytics-skill --skill biostringsgit clone --depth 1 https://github.com/LeoLin990405/r-analytics-skillWrote this? Show the measurements
A badge with what this costs and how it scanned, read live from this page, so it follows the numbers instead of freezing them. Markdown for a README, HTML for a documentation site or a project page.
[](https://agentmods.dev/skills/leolin990405/r-analytics-skill/biostrings)<a href="https://agentmods.dev/skills/leolin990405/r-analytics-skill/biostrings"><img src="https://agentmods.dev/badge/skills/leolin990405/r-analytics-skill/biostrings/github.svg" alt="Measured on agentmods" height="20"></a>Or the 80×15 button, for a site that already has a row of RSS and ATOM ones. Only the verdict fits; the numbers stay here.
<a href="https://agentmods.dev/skills/leolin990405/r-analytics-skill/biostrings"><img src="https://agentmods.dev/badge/skills/leolin990405/r-analytics-skill/biostrings.svg" alt="Reviewed on agentmods" width="80" height="20"></a>What it costs to keep this loaded
Counted locally with the o200k_base tokenizer, which is exact for GPT models; Claude uses its own tokenizer and its counts differ. Treat this as one consistent yardstick across the catalogue rather than a bill. Prices are per million input tokens.
| Model | Per session | Once invoked |
|---|---|---|
| Fable 5.1 | $0.00024 | $0.00519 |
| Opus 5 | $0.00012 | $0.00260 |
| Sonnet 5 | $0.00005 | $0.00104 |
| Haiku 4.5 | $0.00002 | $0.00052 |
Grade A, and why
Biostrings scanned grade A with 0 findings against 26 rules in 11 categories — prompt injection, anti-refusal, data exfiltration, privilege escalation, supply chain, agent snooping, system-prompt leakage, SSRF and excessive agency — measured 9d ago.
A static scan of the body, not an audit. Every finding is printed with the line that produced it so you can judge whether it matters here. A mod is markdown that instructs an agent; that is exactly why what it instructs is worth reading.
Nothing flagged
None of the 26 patterns this scan looks for appear in this file: no shell pipes, no recursive deletes, no credential paths, no hidden text, no instruction-override or anti-refusal phrasing, no agent-config snooping. That is not a guarantee, it is the absence of the things that are checkable.
What it actually says
Biostrings Package
Efficient manipulation of biological sequences.
Create Sequences
library(Biostrings)
# DNA
dna <- DNAString("ATGCGATCGATCG")
dna_set <- DNAStringSet(c("ATGC", "GCTA", "TTAA"))
# RNA
rna <- RNAString("AUGCGAUCGAUCG")
# Amino acids
aa <- AAString("MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAAALEHHHHHH")
Read FASTA
# Read
seqs <- readDNAStringSet("sequences.fasta")
seqs <- readAAStringSet("proteins.fasta")
# Write
writeXStringSet(seqs, "output.fasta")
Basic Operations
# Length
length(dna)
width(dna_set)
# Subset
subseq(dna, start = 1, end = 10)
dna[1:10]
# Reverse complement
reverseComplement(dna)
# Translate
translate(dna)
Pattern Matching
# Find pattern
matchPattern("ATG", dna)
# Count
countPattern("ATG", dna)
# Multiple patterns
vmatchPattern("ATG", dna_set)
# With mismatches
matchPattern("ATG", dna, max.mismatch = 1)
Alignment
# Pairwise alignment
pairwiseAlignment(pattern, subject,
type = "global",
substitutionMatrix = "BLOSUM62"
)
# Score
score(alignment)
# Aligned sequences
aligned(alignment)
Sequence Statistics
# Letter frequency
letterFrequency(dna, letters = c("A", "T", "G", "C"))
# Dinucleotide frequency
dinucleotideFrequency(dna)
# GC content
letterFrequency(dna, "GC", as.prob = TRUE)
# Oligonucleotide frequency
oligonucleotideFrequency(dna, width = 3)
Consensus
# Consensus matrix
consensusMatrix(dna_set)
# Consensus string
consensusString(dna_set)
What this file has done since we first saw it
Hashed on every crawl. A supply-chain change to an agent config is a question of when, not whether, so the history is kept rather than the latest state alone.
- 9d ago First seen · 112 lines · 24 tokens per session scan A ee1c7fc88c4b
Biostrings is a skill published in the GitHub repository LeoLin990405/r-analytics-skill (5 stars, last pushed 5mo ago), licensed MIT. It adds 24 tokens to every session and 519 once invoked, about $0.0001 per session on Opus 5. A static security scan graded it A with 0 findings. No closer match exists in the catalogue, so it is treated as the original; first seen 2026-08-31.
Other skills, from other repositories
alibaba-maestro
Alibaba Cloud Maestro routing skill. Classify the user's Alibaba Cloud task, select the narrowest specialist agent or the right team of specialists from the catalog, and dispatch them — single specialist for focused tasks, parallel team (max 4) for multi-domain tasks. Never auto-dispatch live-guard agents.…
databricks-developer-platform
Use this skill to review a Declarative Automation Bundle configuration, authentication setup, and deployment flow against production readiness criteria: bundle structure, deployment modes, run-as identity boundaries, variable resolution timing, OAuth and environment-variable authentication, Terraform versus direct…
data-classification-to-dlp-protocol
Use this skill when sensitive data must be discovered, classified with Microsoft Purview sensitivity labels, protected by Data Loss Prevention policies, and monitored for label adoption and DLP policy effectiveness across Microsoft 365 and Power Platform environments. Defines the end-to-end flow from data discovery…
alibaba-live-cost-budget-action-guard
Gate live financial authority actions — budget threshold changes, Savings Plan purchases, and Reserved Instance commitments. These are committed spend or can trigger immediate service suspension.
alibaba-live-kms-key-mutation-guard
Gate KMS key deletion and disable operations. All data encrypted with a deleted CMK (OSS SSE-KMS, ECS encrypted disks, RDS/PolarDB TDE) becomes permanently and irrecoverably inaccessible. This guard enforces complete CMK dependency audits, deletion window confirmation, and explicit operator approval before any key…
alibaba-live-ram-policy-change-guard
Gate RAM policy/role mutations against the Alibaba Cloud account hierarchy. RAM AdministratorAccess assignment, policy deletion with active STS tokens, and Resource Directory Control Policy changes carry account-wide or org-wide blast radius. This guard enforces blast-radius assessment, STS token impact analysis, and…