protein-structure-prediction

protein-structure-prediction is a skill for Claude Code from Lord1Egypt/scientific-agent-toolkit. It costs 62 tokens per session (2,323 once invoked), scanned D, original, MIT.

A scientific workflow for predicting a protein’s three-dimensional shape from its amino-acid sequence and analysing the resulting model. It covers tools such as AlphaFold2, ESMFold, RoseTTAFold, and ColabFold.

In plain words
What is it for?
Use it to predict protein or protein-complex structures, compare structures, assess model confidence, identify binding sites and functional regions, and examine possible drug-binding pockets.
Why use it?
It helps when no experimentally determined structure is available, so researchers can examine a likely shape and assess how reliable the prediction is.

Skill for Claude Code

Written for Claude Code: allowed-tools in frontmatter.

Good fit Use it to predict protein or protein-complex structures, compare structures, assess model confidence, identify binding sites and functional regions, and examine possible drug-binding pockets.

Compare 6 skills from other repositories ↓
Install with agentmods
npx agentmods add skills/lord1egypt/scientific-agent-toolkit/protein-structure-prediction
Install

Getting it into your agent

One page per mod, every tool's command on it. A separate URL per tool would split the same page into five that compete with each other.

Any agent
npx skills add Lord1Egypt/scientific-agent-toolkit --skill protein-structure-prediction
Clone the repo
git clone --depth 1 https://github.com/Lord1Egypt/scientific-agent-toolkit

Made for: Claude Code.

Wrote this? Show the measurements

A badge with what this costs and how it scanned, read live from this page, so it follows the numbers instead of freezing them. Markdown for a README, HTML for a documentation site or a project page.

agentmods badge for protein-structure-prediction

README.md
[![agentmods](https://agentmods.dev/badge/skills/lord1egypt/scientific-agent-toolkit/protein-structure-prediction/github.svg)](https://agentmods.dev/skills/lord1egypt/scientific-agent-toolkit/protein-structure-prediction)
Your own site
<a href="https://agentmods.dev/skills/lord1egypt/scientific-agent-toolkit/protein-structure-prediction"><img src="https://agentmods.dev/badge/skills/lord1egypt/scientific-agent-toolkit/protein-structure-prediction/github.svg" alt="Measured on agentmods" height="20"></a>

Or the 80×15 button, for a site that already has a row of RSS and ATOM ones. Only the verdict fits; the numbers stay here.

agentmods 80×15 button for protein-structure-prediction

Your own site · 80×15
<a href="https://agentmods.dev/skills/lord1egypt/scientific-agent-toolkit/protein-structure-prediction"><img src="https://agentmods.dev/badge/skills/lord1egypt/scientific-agent-toolkit/protein-structure-prediction.svg" alt="Reviewed on agentmods" width="80" height="20"></a>
Per session 62 Skills are progressive disclosure: only the name and description are preloaded; the body loads when the skill is used.
When invoked 2,323 The whole file, excluding the scripts and references it only reads on demand.
Security scan D 3 findings. A grade says what 26 rules found in the file — not that it is safe.
Origin original No closer match found in the catalogue.
Token cost

What it costs to keep this loaded

Counted locally with the o200k_base tokenizer, which is exact for GPT models; Claude uses its own tokenizer and its counts differ. Treat this as one consistent yardstick across the catalogue rather than a bill. Prices are per million input tokens.

ModelPer sessionOnce invoked
Fable 5.1 $0.00062 $0.02323
Opus 5 $0.00031 $0.01162
Sonnet 5 $0.00012 $0.00465
Haiku 4.5 $0.00006 $0.00232

Measured 9d ago against content hash 2e1cc5969249, method: parsed. Prices are Anthropic first-party input rates as of 2026-09-12, from the pricing page.

Security

Grade D, and why

protein-structure-prediction scanned grade D with 3 findings against 26 rules in 11 categories — prompt injection, anti-refusal, data exfiltration, privilege escalation, supply chain, agent snooping, system-prompt leakage, SSRF and excessive agency — measured 9d ago.

A static scan of the body, not an audit. Every finding is printed with the line that produced it so you can judge whether it matters here. A mod is markdown that instructs an agent; that is exactly why what it instructs is worth reading.

Sends data to an external URLmediumData exfiltration

A POST to an outside endpoint may be telemetry or may be exfiltration; either way the mod talks to somewhere, and you should know where.

response = requests.post( "https://api.esmatlas.com/foldSequence/v1/pdb/",

Encoded or obfuscated payloadhighSupply chain

base64 or hex that is decoded and executed hides what actually runs from anyone reading the file.

sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDG

Makes network callslowCapability

Not a fault in itself. Listed so you know the mod talks to something, and to what.

response = requests.post(
scientific-skills/protein-structure-prediction/SKILL.md · 256 lines

How it starts

The opening of the file, as written. The whole thing — 256 lines — stays where its author put it; the contents beside it link to each section on GitHub.

Protein Structure Prediction

Overview

Protein structure prediction enables researchers to computationally determine the 3D conformation of proteins directly from their amino acid sequences. This skill covers AlphaFold2, ESMFold, RoseTTAFold, and ColabFold for structure prediction, alongside tools for quality assessment, structural alignment, and downstream analysis.

When to Use This Skill

  • Predicting 3D structures of proteins with no experimental structure available
  • Comparing predicted vs. experimental structures (PDB)
  • Identifying binding sites and functional residues
  • Modelling protein complexes (multimers) and protein-protein interactions
  • Assessing model confidence using pLDDT scores and PAE maps
  • Performing structural alignment and RMSD calculations
  • Screening for druggable pockets in predicted structures

Quick Start

ESMFold (Fast, API-based)

import requests

def predict_structure_esmfold(sequence: str) -> str:
    """Predict structure via ESMFold API, returns PDB string."""
    response = requests.post(
        "https://api.esmatlas.com/foldSequence/v1/pdb/",
        headers={"Content-Type": "application/x-www-form-urlencoded"},
        data=sequence,
        timeout=120,
    )
    response.raise_for_status()
    return response.text

sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAGVWPAAVRESVPSLL"

pdb_string = predict_structure_esmfold(sequence)
with open("predicted_structure.pdb", "w") as f:
    f.write(pdb_string)
print("Structure saved to predicted_structure.pdb")

ColabFold (AlphaFold2 via MSA server)

# Install ColabFold
pip install colabfold[alphafold]

# Run prediction (single sequence)
colabfold_batch input.fasta output_dir/ --num-recycle 3 --num-models 5

Read the full file on GitHub · 256 lines

Changes

What this file has done since we first saw it

Hashed on every crawl. A supply-chain change to an agent config is a question of when, not whether, so the history is kept rather than the latest state alone.

  1. 9d ago First seen · 256 lines · 62 tokens per session scan D 2e1cc5969249

Subscribe to this mod's changes

protein-structure-prediction is a skill published in the GitHub repository Lord1Egypt/scientific-agent-toolkit (3 stars, last pushed 3mo ago), licensed MIT. It adds 62 tokens to every session and 2,323 once invoked, about $0.0003 per session on Opus 5. A static security scan graded it D with 3 findings (sends data to an external url, encoded or obfuscated payload, makes network calls). No closer match exists in the catalogue, so it is treated as the original; first seen 2026-09-03.

Related

Other skills, from other repositories

cellxgene-census-query

Query CZ CELLxGENE Census (61M+ cells). Filter by cell type/tissue/disease, retrieve expression data, and integrate with scanpy/PyTorch for population-scale single-cell analysis. Use this skill when: (1) Querying single-cell expression data by cell type, tissue, or disease, (2) Exploring available single-cell datasets…

PharMolix/OpenBioMed · 105 tokens

alterlab-deep-research

Runs a 13-agent deep research pipeline for rigorous academic work on any topic across 7 modes (full research, quick brief, paper review, lit-review, fact-check, Socratic guided research dialogue, and systematic review with optional meta-analysis), covering research-question formulation, Socratic mentoring, methodology…

AlterLab-IEU/AlterLab-Academic-Skills · 239 tokens

alterlab-imaging-data-commons

Query and download public cancer imaging data from the NCI Imaging Data Commons (IDC) using the idc-index Python package, filtering by metadata, visualizing in-browser, and checking licenses, with no authentication required. Use when obtaining large-scale radiology (CT, MR, PET) or digital pathology DICOM datasets for…

AlterLab-IEU/AlterLab-Academic-Skills · 90 tokens

alterlab-pyhealth

Develops, tests, and deploys clinical machine learning models with the PyHealth healthcare AI toolkit. Use when working with electronic health records (EHR), clinical prediction tasks (mortality, readmission, drug recommendation), medical coding systems (ICD, NDC, ATC), physiological signals (EEG, ECG), healthcare…

AlterLab-IEU/AlterLab-Academic-Skills · 117 tokens

alterlab-cobrapy

Build and analyze genome-scale constraint-based metabolic models with COBRApy — flux balance analysis (FBA), flux variability analysis (FVA), gene and reaction knockouts, flux sampling, and SBML model I/O. Use when simulating metabolic networks, predicting growth or knockout phenotypes, or running systems-biology and…

AlterLab-IEU/AlterLab-Academic-Skills · 91 tokens

alterlab-deeptools

Process and visualize deep-sequencing coverage with the deepTools CLI — convert BAM to bigWig (bamCoverage), build log2 ratio tracks (bamCompare), run QC (multiBamSummary correlation, PCA, plotFingerprint), apply the ATAC-seq Tn5 shift (alignmentSieve --ATACshift), and make TSS/peak heatmaps and profiles…

AlterLab-IEU/AlterLab-Academic-Skills · 173 tokens