Getting it into your agent
One page per mod, every tool's command on it. A separate URL per tool would split the same page into five that compete with each other.
npx skills add beita6969/ScienceClaw --skill pdb-structuregit clone --depth 1 https://github.com/beita6969/ScienceClawWrote this? Show the measurements
A badge with what this costs and how it scanned, read live from this page, so it follows the numbers instead of freezing them. Markdown for a README, HTML for a documentation site or a project page.
[](https://agentmods.dev/skills/beita6969/scienceclaw/pdb-structure)<a href="https://agentmods.dev/skills/beita6969/scienceclaw/pdb-structure"><img src="https://agentmods.dev/badge/skills/beita6969/scienceclaw/pdb-structure/github.svg" alt="Measured on agentmods" height="20"></a>Or the 80×15 button, for a site that already has a row of RSS and ATOM ones. Only the verdict fits; the numbers stay here.
<a href="https://agentmods.dev/skills/beita6969/scienceclaw/pdb-structure"><img src="https://agentmods.dev/badge/skills/beita6969/scienceclaw/pdb-structure.svg" alt="Reviewed on agentmods" width="80" height="20"></a>- NVIDIA SkillSpector warn
SkillSpector: 4 findings, up to medium
These are SkillSpector’s own severities. On a checked sample its high-severity flags on skills were ~96% false positives — a documented command, a public API, a “never do X” rule — so we show them as a caution to read, not a verdict. Why →
- medium Data Exfiltration · line 21 Data is being sent to an external URL. This could be legitimate telemetry or data exfiltration. Manual review is recommended.Fix: Verify the destination URL is trusted and necessary. Remove or replace with documented APIs. Ensure no secrets, tokens, or PII are transmitted.
- medium Data Exfiltration · line 21 Data is being sent to an external URL. This could be legitimate telemetry or data exfiltration. Manual review is recommended.Fix: Verify the destination URL is trusted and necessary. Remove or replace with documented APIs. Ensure no secrets, tokens, or PII are transmitted.
- medium Data Exfiltration · line 24 Data is being sent to an external URL. This could be legitimate telemetry or data exfiltration. Manual review is recommended.Fix: Verify the destination URL is trusted and necessary. Remove or replace with documented APIs. Ensure no secrets, tokens, or PII are transmitted.
- medium Data Exfiltration · line 108 Data is being sent to an external URL. This could be legitimate telemetry or data exfiltration. Manual review is recommended.Fix: Verify the destination URL is trusted and necessary. Remove or replace with documented APIs. Ensure no secrets, tokens, or PII are transmitted.
What it costs to keep this loaded
Counted locally with the o200k_base tokenizer, which is exact for GPT models; Claude uses its own tokenizer and its counts differ. Treat this as one consistent yardstick across the catalogue rather than a bill. Prices are per million input tokens.
| Model | Per session | Once invoked |
|---|---|---|
| Fable 5.1 | $0.00080 | $0.01291 |
| Opus 5 | $0.00040 | $0.00646 |
| Sonnet 5 | $0.00016 | $0.00258 |
| Haiku 4.5 | $0.00008 | $0.00129 |
Grade A, and why
pdb-structure scanned grade A with 1 finding against 26 rules in 11 categories — prompt injection, anti-refusal, data exfiltration, privilege escalation, supply chain, agent snooping, system-prompt leakage, SSRF and excessive agency — measured 9d ago.
A static scan of the body, not an audit. Every finding is printed with the line that produced it so you can judge whether it matters here. A mod is markdown that instructs an agent; that is exactly why what it instructs is worth reading.
Makes network callslowCapability
Not a fault in itself. Listed so you know the mod talks to something, and to what.
metadata: { "openclaw": { "emoji": "🧊", "requires": { "bins": ["curl"] } } } How it starts
The opening of the file, as written. The whole thing — 128 lines — stays where its author put it; the contents beside it link to each section on GitHub.
RCSB Protein Data Bank (PDB) API
Access the RCSB PDB to search, retrieve, and download macromolecular 3D structures. Covers X-ray crystallography, cryo-EM, NMR, and other experimental methods. No authentication required.
API Endpoints
Data API Base: https://data.rcsb.org
Search API Base: https://search.rcsb.org
File Downloads: https://files.rcsb.org
GET /rest/v1/core/entry/{pdb_id} -- Structure metadata
# Get full metadata for a PDB entry (human hemoglobin)
curl -s "https://data.rcsb.org/rest/v1/core/entry/1HBB"
# Get entry metadata for SARS-CoV-2 spike protein structure
curl -s "https://data.rcsb.org/rest/v1/core/entry/6VYB"
POST /rcsbsearch/v2/query -- Advanced search API
# Search by text (protein name)
curl -s -X POST "https://search.rcsb.org/rcsbsearch/v2/query" \
-H "Content-Type: application/json" \
-d '{
"query": {
"type": "terminal",
"service": "full_text",
"parameters": { "value": "insulin receptor" }
},
"return_type": "entry",
"request_options": { "paginate": { "start": 0, "rows": 10 } }
}'
# Search by organism and resolution
curl -s -X POST "https://search.rcsb.org/rcsbsearch/v2/query" \
-H "Content-Type: application/json" \
-d '{
"query": {
"type": "group",
"logical_operator": "and",
"nodes": [
{
"type": "terminal",
"service": "text",
"parameters": {
"attribute": "rcsb_entity_source_organism.ncbi_scientific_name",
"operator": "exact_match",
"value": "Homo sapiens"
}
},
{
"type": "terminal",
"service": "text",
"parameters": {
"attribute": "rcsb_entry_info.resolution_combined",
"operator": "less",
"value": 2.0
}
}
]
},
"return_type": "entry",
"request_options": { "paginate": { "start": 0, "rows": 10 } }
}'
# Search by sequence similarity (BLAST-like)
curl -s -X POST "https://search.rcsb.org/rcsbsearch/v2/query" \
-H "Content-Type: application/json" \
-d '{
"query": {
"type": "terminal",
"service": "sequence",
"parameters": {
"evalue_cutoff": 0.001,
"identity_cutoff": 0.9,
"sequence_type": "protein",
"value": "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
}
},
"return_type": "polymer_entity",
"request_options": { "paginate": { "start": 0, "rows": 10 } }
}'
What this file has done since we first saw it
Hashed on every crawl. A supply-chain change to an agent config is a question of when, not whether, so the history is kept rather than the latest state alone.
- 9d ago First seen · 128 lines · 80 tokens per session scan A 86a4e167dcd5
pdb-structure is a skill published in the GitHub repository beita6969/ScienceClaw (898 stars, last pushed 3mo ago), licensed MIT. It adds 80 tokens to every session and 1,291 once invoked, about $0.0004 per session on Opus 5. A static security scan graded it A with 1 finding (makes network calls). No closer match exists in the catalogue, so it is treated as the original; first seen 2026-09-03.
Other skills, from other repositories
biopython
Comprehensive molecular biology toolkit. Use for sequence manipulation, file parsing (FASTA/GenBank/PDB), phylogenetics, and programmatic NCBI/PubMed access (Bio.Entrez). Best for batch processing, custom bioinformatics pipelines, BLAST automation. For quick lookups use gget; for multi-service integration use…
scanpy
Standard single-cell RNA-seq analysis pipeline. Use for QC, normalization, dimensionality reduction (PCA/UMAP/t-SNE), clustering, differential expression, and visualization. Best for exploratory scRNA-seq analysis with established workflows. For deep learning models use scvi-tools; for data format questions use…
structure-prediction
Protein structure prediction from sequence. ESMFold-based, single GPU, no MSA needed. Predicts 3D structures with pLDDT confidence scores for drug discovery targets.
biomcp
Search and retrieve biomedical data - genes, variants, clinical trials, diagnostic tests, articles, drugs, diseases, pathways, proteins, adverse events, pharmacogenomics, and phenotype-disease matching. Use for gene function, variant pathogenicity, trials, diagnostics, drug safety, pathway context, disease workups…
biomcp-research
Do biomedical literature and variant research with the BioMCP CLI, and file what you learn about the tool itself as issues in the biomcp repo.
biological-expert
Expert-level biology, biotechnology, genetics, bioinformatics, and computational biology. Use when the user mentions biology, biotechnology, genetics, bioinformatics, or genomics, or when the task involves Molecular Biology, Genomics & Bioinformatics, Systems Biology, or Data Analysis.