boltz

boltz is a skill for Claude Code, Codex from naity/FM4Life. It costs 133 tokens per session (2,467 once invoked), scanned A, original, MIT.

A model that predicts 3D structures of biomolecular complexes and estimates how strongly a molecule may bind. It works with proteins, DNA, RNA, ligands, and cyclic peptides, and can output common structure files such as PDB or mmCIF.

In plain words
What is it for?
Use it to model protein–molecule complexes, estimate measures such as IC50 or binding free energy, screen compound libraries, add binding-pocket constraints, or study protein–DNA and protein–RNA interactions.
Why use it?
It combines structure prediction and binding-affinity estimation in one run, helping reduce the need for separate tools when screening or improving drug candidates.

Skill for Claude CodeCodex

Written for no agent in particular: nothing here depends on one.

Needs its repository: it runs a file that does not travel with it, so clone the repository first. The line is msa: ./msas/protein_a.a3m.

Good fit Use it to model protein–molecule complexes, estimate measures such as IC50 or binding free energy, screen compound libraries, add binding-pocket constraints, or study protein–DNA and protein–RNA interactions.

Compare 6 skills from other repositories ↓
Install

Getting it into your agent

It runs from inside its repository, so the clone comes first — what it calls does not travel with the file alone.

Clone the repo
git clone --depth 1 https://github.com/naity/FM4Life
agentmods
npx agentmods add skills/naity/fm4life/boltz

Made for: Claude Code, Codex.

Wrote this? Show the measurements

A badge with what this costs and how it scanned, read live from this page, so it follows the numbers instead of freezing them. Markdown for a README, HTML for a documentation site or a project page.

agentmods badge for boltz

README.md
[![agentmods](https://agentmods.dev/badge/skills/naity/fm4life/boltz/github.svg)](https://agentmods.dev/skills/naity/fm4life/boltz)
Your own site
<a href="https://agentmods.dev/skills/naity/fm4life/boltz"><img src="https://agentmods.dev/badge/skills/naity/fm4life/boltz/github.svg" alt="Measured on agentmods" height="20"></a>

Or the 80×15 button, for a site that already has a row of RSS and ATOM ones. Only the verdict fits; the numbers stay here.

agentmods 80×15 button for boltz

Your own site · 80×15
<a href="https://agentmods.dev/skills/naity/fm4life/boltz"><img src="https://agentmods.dev/badge/skills/naity/fm4life/boltz.svg" alt="Reviewed on agentmods" width="80" height="20"></a>
Per session 133 Skills are progressive disclosure: only the name and description are preloaded; the body loads when the skill is used.
When invoked 2,467 The whole file, excluding the scripts and references it only reads on demand.
Security scan A 0 findings. A grade says what 26 rules found in the file — not that it is safe.
Origin original No closer match found in the catalogue.
Token cost

What it costs to keep this loaded

Counted locally with the o200k_base tokenizer, which is exact for GPT models; Claude uses its own tokenizer and its counts differ. Treat this as one consistent yardstick across the catalogue rather than a bill. Prices are per million input tokens.

ModelPer sessionOnce invoked
Fable 5.1 $0.00133 $0.02467
Opus 5 $0.00067 $0.01234
Sonnet 5 $0.00027 $0.00493
Haiku 4.5 $0.00013 $0.00247

Measured 9d ago against content hash d3b082f2a001, method: parsed. Prices are Anthropic first-party input rates as of 2026-09-09, from the pricing page.

Security

Grade A, and why

boltz scanned grade A with 0 findings against 26 rules in 11 categories — prompt injection, anti-refusal, data exfiltration, privilege escalation, supply chain, agent snooping, system-prompt leakage, SSRF and excessive agency — measured 9d ago.

The scan reads SKILL.md. This mod also ships 1 executable file (scripts/build_input.py), listed below but not scanned — reading those needs a real analyzer, not pattern matching.

A static scan of the body, not an audit. Every finding is printed with the line that produced it so you can judge whether it matters here. A mod is markdown that instructs an agent; that is exactly why what it instructs is worth reading.

Nothing flagged

None of the 26 patterns this scan looks for appear in this file: no shell pipes, no recursive deletes, no credential paths, no hidden text, no instruction-override or anti-refusal phrasing, no agent-config snooping. That is not a guarantee, it is the absence of the things that are checkable.

skills/boltz/SKILL.md · 282 lines

How it starts

The opening of the file, as written. The whole thing — 282 lines — stays where its author put it; the contents beside it link to each section on GitHub.

Boltz-2: Biomolecular Structure and Binding Affinity Prediction

Overview

Boltz-2 is a biomolecular foundation model that jointly predicts complex 3D structure and binding affinity in a single inference pass. It is the first fully open-source model to approach AlphaFold 3-level structural accuracy while also providing quantitative affinity predictions 1000× faster than physics-based FEP methods.

Capability Boltz-2 AlphaFold 3
Proteins, RNA, DNA, ligands
Binding affinity prediction
Pocket/contact constraints
Cyclic peptides
License MIT (commercial OK) CC-BY-NC-SA 4.0
Model weights Freely available Must apply to Google
Input format YAML JSON
Output format mmCIF or PDB mmCIF only

Installation

pip install boltz[cuda] -U

For CPU-only (slow, for testing):

pip install boltz -U

Requirements: Python ≥ 3.10, < 3.13; NVIDIA GPU recommended.

Quick Start

# Predict structure (auto-generate MSA via server)
boltz predict input.yaml --use_msa_server

# Predict structure + binding affinity
boltz predict complex.yaml --use_msa_server --diffusion_samples 5

# Multiple samples for ensemble
boltz predict input.yaml --use_msa_server --diffusion_samples 5

Input Format (YAML)

Boltz-2 uses YAML input files. See references/input-format.md for the full schema.

Single protein

version: 1
sequences:
  - protein:
      id: A
      sequence: MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD

Protein–ligand complex

version: 1
sequences:
  - protein:
      id: A
      sequence: MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD
      msa: ./msas/protein_a.a3m
  - ligand:
      id: B
      ccd: ATP
  - ligand:
      id: C
      ccd: MG

With binding affinity prediction

Add a properties block with one small molecule as the binder:

version: 1
sequences:
  - protein:
      id: A
      sequence: MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD
      msa: ./msas/protein_a.a3m
  - ligand:
      id: B
      smiles: "CC(=O)Nc1ccc(O)cc1"
properties:
  - affinity:
      binder: B

Read the full file on GitHub · 282 lines

Files

What ships with it

3 files beside SKILL.md in the same directory: the scripts, references and assets a skill reads on demand. Not counted in the per-session cost; read them before you install if any of them is executable.

Changes

What this file has done since we first saw it

Hashed on every crawl. A supply-chain change to an agent config is a question of when, not whether, so the history is kept rather than the latest state alone.

  1. 9d ago First seen · 282 lines · 133 tokens per session scan A d3b082f2a001

Subscribe to this mod's changes

boltz is a skill published in the GitHub repository naity/FM4Life (2 stars, last pushed 5mo ago), licensed MIT. It adds 133 tokens to every session and 2,467 once invoked, about $0.0007 per session on Opus 5. A static security scan graded it A with 0 findings. No closer match exists in the catalogue, so it is treated as the original; first seen 2026-08-31.

Related

Other skills, from other repositories

drug-repurposing

Systematic drug repurposing via signature matching, target-based analysis, network proximity, genetic evidence scoring, and clinical evidence mining.

inflexa-ai/inflexa · 30 tokens

genomic-variants

Analysis of called genomic variants — filtering, annotation, GWAS, and population-genetics summaries from VCF and PLINK-format data.

inflexa-ai/inflexa · 31 tokens

omics-general

Cross-cutting principles for all omics analysis — AnnData/MuData universal containers, Python-first policy, data format detection, analysis phases, and shared analytical methods.

inflexa-ai/inflexa · 36 tokens

external-model-validation

Use when validating an existing prognostic risk signature on an external bulk expression cohort with survival outcomes, producing risk scores, Kaplan-Meier curves, risk distribution plots, heatmap, and time-dependent ROC curves. NOT for: model training, feature selection, nomogram construction, calibration analysis…

aipoch/medical-research-skills · 66 tokens

gsva-analysis-and-visualization

Use this skill to run GSVA or ssGSEA pathway-level differential analysis from a bulk expression matrix and a sample group file, then generate a heatmap from the saved GSVA result object. Trigger keywords: GSVA, ssGSEA, pathway enrichment, KEGG pathway analysis, MSigDB. NOT for: gene-level differential expression…

aipoch/medical-research-skills · 88 tokens

medical-research-literature-reader-pro

A medical-research-native literature reading skill for users with clinical, bioinformatics, translational, and basic experimental backgrounds. Use this skill whenever a user wants to read, analyze, critique, or interpret a medical or scientific paper — whether they provide a PDF, abstract, DOI, PMID, or just a title.…

aipoch/medical-research-skills · 199 tokens