esmc

esmc is a skill for Claude Code, Codex from naity/FM4Life. It costs 143 tokens per session (1,709 once invoked), scanned A, original, MIT.

A guide for creating numerical representations of protein sequences with ESM-C, a protein-focused language model from EvolutionaryScale. These representations let software compare and analyze proteins.

In plain words
What is it for?
Use it to compare protein sequences, classify or predict properties, group similar proteins, and build a searchable similarity index from embeddings.
Why use it?
It helps developers choose and use an ESM-C model for protein analysis without building the embedding workflow from scratch.

Skill for Claude CodeCodex

Written for no agent in particular: nothing here depends on one.

Install

Getting it into your agent

One page per mod, every tool's command on it. A separate URL per tool would split the same page into five that compete with each other.

agentmods
npx agentmods add skills/naity/fm4life/esmc
Any agent
npx skills add naity/FM4Life --skill esmc
Clone the repo
git clone --depth 1 https://github.com/naity/FM4Life

Made for: Claude Code, Codex.

Wrote this? Show the measurements

A badge with what this costs and how it scanned, read live from this page, so it follows the numbers instead of freezing them. Markdown for a README, HTML for a documentation site or a project page.

agentmods badge for esmc

README.md
[![agentmods](https://agentmods.dev/badge/skills/naity/fm4life/esmc.svg)](https://agentmods.dev/skills/naity/fm4life/esmc)
Your own site
<a href="https://agentmods.dev/skills/naity/fm4life/esmc"><img src="https://agentmods.dev/badge/skills/naity/fm4life/esmc.svg" alt="Measured on agentmods" height="20"></a>
Per session 143 Skills are progressive disclosure: only the name and description are preloaded; the body loads when the skill is used.
When invoked 1,709 The whole file, excluding the scripts and references it only reads on demand.
Security scan A 0 findings. Scan, not verified.
Origin original No closer match found in the catalogue.
Token cost

What it costs to keep this loaded

Counted locally with the o200k_base tokenizer, which is exact for GPT models; Claude uses its own tokenizer and its counts differ. Treat this as one consistent yardstick across the catalogue rather than a bill. Prices are per million input tokens.

ModelPer sessionOnce invoked
Fable 5.1 $0.00143 $0.01709
Opus 5 $0.00072 $0.00855
Sonnet 5 $0.00029 $0.00342
Haiku 4.5 $0.00014 $0.00171

Measured 6d ago against content hash 447bb7a2c912, method: parsed. Prices are Anthropic first-party input rates as of 2026-09-06, from the pricing page.

Security

Grade A, and why

esmc scanned grade A with 0 findings against 26 rules in 11 categories — prompt injection, anti-refusal, data exfiltration, privilege escalation, supply chain, agent snooping, system-prompt leakage, SSRF and excessive agency — measured 6d ago.

The scan reads SKILL.md. This mod also ships 1 executable file (scripts/embed.py), listed below but not scanned — reading those needs a real analyzer, not pattern matching.

A static scan of the body, not an audit. Every finding is printed with the line that produced it so you can judge whether it matters here. A mod is markdown that instructs an agent; that is exactly why what it instructs is worth reading.

Nothing flagged

None of the 26 patterns this scan looks for appear in this file: no shell pipes, no recursive deletes, no credential paths, no hidden text, no instruction-override or anti-refusal phrasing, no agent-config snooping. That is not a guarantee, it is the absence of the things that are checkable.

skills/esmc/SKILL.md · 178 lines

How it starts

The opening of the file, as written. The whole thing — 178 lines — stays where its author put it; the contents beside it link to each section on GitHub.

ESM-C: Efficient Protein Embeddings

Overview

ESM-C (Cambrian) is EvolutionaryScale's embedding-focused protein language model family, designed as a drop-in upgrade to ESM2 with ~3× faster inference and improved embedding quality across all model sizes.

Choosing between ESM-C and ESM2:

  • Use ESM-C when embeddings are the primary goal — it's faster and produces better representations
  • Use ESM2 when you also need variant effect scoring (EsmForMaskedLM), contact prediction, or ESMFold structure prediction — those capabilities are not available in ESM-C

Installation

pip install esm

ESM-C models are also available on HuggingFace (evolutionaryscale/esmc-300m-2024-12, esmc-600m-2024-12) if you prefer the transformers ecosystem.

Model Selection

Model Params Layers Hidden dim Use case
esmc-300m 300M 30 960 Fast inference, large batches, CPU-friendly
esmc-600m 600M 36 1152 Default — good quality/speed balance
esmc-6b 6B 80 2560 Maximum quality for downstream tasks

Start with esmc-600m; drop to esmc-300m for real-time or CPU applications.

Core Usage

Basic Embeddings

from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import torch.nn.functional as F

model = ESMC.from_pretrained("esmc-600m").to("cuda")
model.eval()

sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD"
protein = ESMProtein(sequence=sequence)
output = model.forward(model.encode(protein))

# output.embeddings: (1, seq_len, hidden_dim) — residues only, no special tokens to strip
per_residue  = output.embeddings[0]                              # (L, 1152)
per_sequence = per_residue.mean(dim=0)                           # (1152,)
per_sequence_norm = F.normalize(per_sequence.unsqueeze(0), dim=-1)  # L2 normalized

Key difference from ESM2: there are no [CLS]/[EOS] special tokens to strip. output.embeddings[0] is already residue-only.

Read the full file on GitHub · 178 lines

Files

What ships with it

2 files beside SKILL.md in the same directory: the scripts, references and assets a skill reads on demand. Not counted in the per-session cost; read them before you install if any of them is executable.

Changes

What this file has done since we first saw it

Hashed on every crawl. A supply-chain change to an agent config is a question of when, not whether, so the history is kept rather than the latest state alone.

  1. 6d ago First seen · 178 lines · 143 tokens per session scan A 447bb7a2c912

Subscribe to this mod's changes

esmc is a skill published in the GitHub repository naity/FM4Life (2 stars, last pushed 5mo ago), licensed MIT. It adds 143 tokens to every session and 1,709 once invoked, about $0.0007 per session on Opus 5. A static security scan graded it A with 0 findings. No closer match exists in the catalogue, so it is treated as the original; first seen 2026-08-31.

Related

Other skills, from other repositories

gsva-analysis-and-visualization

Use this skill to run GSVA or ssGSEA pathway-level differential analysis from a bulk expression matrix and a sample group file, then generate a heatmap from the saved GSVA result object. Trigger keywords: GSVA, ssGSEA, pathway enrichment, KEGG pathway analysis, MSigDB. NOT for: gene-level differential expression…

aipoch/medical-research-skills · 88 tokens

medical-research-literature-reader-pro

A medical-research-native literature reading skill for users with clinical, bioinformatics, translational, and basic experimental backgrounds. Use this skill whenever a user wants to read, analyze, critique, or interpret a medical or scientific paper — whether they provide a PDF, abstract, DOI, PMID, or just a title.…

aipoch/medical-research-skills · 199 tokens

anatomy-quiz-master

Generate interactive anatomy quizzes for medical education with multiple.

aipoch/medical-research-skills · 17 tokens

cibersort-immune-infiltration-analysis

Use when estimating relative immune cell infiltration from a bulk expression matrix with a CIBERSORT-style nu-SVR deconvolution workflow based on an LM22 signature matrix, comparing one case group against one control group, and generating structured tables plus immune-fraction plots. NOT for single-cell RNA-seq…

aipoch/medical-research-skills · 92 tokens

estimate-immune-score-analysis

Use this skill to compute ESTIMATE immune-related microenvironment scores from a bulk expression matrix, generate an ESTIMATE score heatmap, and optionally generate group-wise ESTIMATE score boxplots plus significance tables when a sample group file is supplied. Trigger keywords: ESTIMATE, immune score, stromal score…

aipoch/medical-research-skills · 90 tokens

knn-imputation

Use when filtering genes with high missingness and then imputing missing values in a bulk expression matrix with group-aware KNN through DMwR2, where donor samples are restricted by one annotation column before imputation. For strata with 10 or fewer samples, the script falls back to row-wise direct filling with mean…

aipoch/medical-research-skills · 95 tokens